Sign In | Join Free | My chinaqualitylighting.com
chinaqualitylighting.com
Products
Search by Category
Wholesale Marketplace
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    sermorelin and ghrp 6

    All sermorelin and ghrp 6 wholesalers & sermorelin and ghrp 6 manufacturers come from members. We doesn't provide sermorelin and ghrp 6 products or service, please contact them directly and verify their companies info carefully.

    Total 10465 products from sermorelin and ghrp 6 Manufactures & Suppliers
    Wholesale Sermorelin bodybuilding benefits Sermorelin Acetate ghrp-6 uses reviews buy online from china suppliers

    Brand Name:steriodshow

    Model Number:Sermorelin Acetate CAS 86168-78-7

    Place of Origin:china manufactuer

    Sermorelin Acetate Cas No.: 86168-78-7 Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity ...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Wholesale 98% Raw Sermorelin Human Growth Peptides Sermorelin White powder for Body - building from china suppliers

    Brand Name:Yuancheng

    Model Number:86168-78-7

    Place of Origin:Wuhan,Hubei

    98% Raw Sermorelin Human Growth Peptides Sermorelin White powder for Body - building Sermorelin - synthetic version of the peptide hormone GHRH Cas No.: 86168-78-7 Purity (HPLC): ...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale Body Building Sermorelin Peptide Steroid Hormones White Powder 86168-78-7 from china suppliers

    Brand Name:JNJG

    Model Number:86168-78-7

    Place of Origin:CHINA

    White Powder Peptides 2mg/Vial Sermorelin Acetate For Bodybuilding 86168-78-7 Sermorelin Specification: Product Name Sermorelin Sermorelin CAS 86168-78-7 Sermorelin Alias ...

    Jinan  Jiage  Biological Technology Co.,Ltd
    Verified Supplier

    Shandong

    Wholesale 10mg/Vial Fat Loss Freeze Dried White Powder Peptide-6 Ghrp-6 87616-84-0 from china suppliers

    Brand Name:Pharmagrade Steroids

    Model Number:87616-84-0

    Place of Origin:China

    GHRP-6 release peptide-6 GHRP-6 10mg/vial*10vial/kit Description: CAS: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular Weight: 873.01 Molecular weight: 873.01 Molar Mass: 873...

    HUBEI PHARMAGRADE STEROIDS., LTD
    Verified Supplier

    Wholesale Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 from china suppliers

    Brand Name:Shuangbojie

    Model Number:nutrition@chembj.com

    Place of Origin:China

    Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Wholesale CAS 86168-78-7 Human Growth Peptides Sermorelin Acetate 2mg Sermorelin Hormone from china suppliers

    Brand Name:Guangzhou Huao

    Model Number:86168-78-7

    Place of Origin:Guangzhou China

    Human Growth Peptides Sermorelin Acetate 2mg Sermorelin Hormone CAS 86168-78-7 Sermorelin Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Molecular ...

    Guangzhou Huao Chemical Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale Pharmaceutical Growth Hormone Peptides GHRP-2 5MG Releasing Peptide For Muscle Gain and Anti Aging from china suppliers

    Brand Name:BestSteroid

    Model Number:158861-67-7

    Place of Origin:Hubei,China

    Growth Hormone Peptides GHRP-2 5MG Releasing Peptide For Muscle Gain and Anti Aging GHRP-2 Basic Info GHRP-2 (Pralmorelin) Alias: GHRP-2 Acetate CAS: 158861-67-7 M.F.: C42H50N8O5 M...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale 99.9% Injectable Human ( Growth ) Peptide Hormone Ghrp-6 for Muscle Growth from china suppliers

    Brand Name:HZ

    Model Number:CAS:87616-84-0

    Place of Origin:China

    99.9% Injectable Human (Growth) Peptide Hormone Ghrp-6 for Muscle Gaining Quick detail Ghrp-6 Product Name;GHRP-6 Ghrp-6 Chemical Name;Growth hormon releasing peptide-6 Ghrp-6 CAS ...

    Wuhan Hezhong Biochemical Manufacturing Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale Human Growth Peptides GHRP-2 5mg and GHRP-6 ( Growth Hormone Releasing Hexapeptide ) from china suppliers

    Brand Name:ChineseHormone

    Model Number:CAS 87616-84-0

    Place of Origin:China

    GHRP-2 5mg and GHRP-6 (Growth Hormone Releasing Hexapeptide) Unit Size 5mg Appearance Lyophilized White Powder CAS NO. 87616-84-0 Molecular Weight 873.01 Molecular Formula ...

    HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
    Verified Supplier

    Hong Kong

    Wholesale Ghrp-6 Bodybuilding Prohormones for Muscle man 10mg/Vial 98% High Purity from china suppliers

    Brand Name:Yuancheng

    Place of Origin:China

    Model Number:steroidchina.com

    GHRP-6 (Growth hormone releasing peptide) Ghrp-6 Growth hormone releasing peptide CAS 87616-84-0 Factory Direct English Title: Growth hormone releasing peptide Alias: GROWTH ...

    Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
    Verified Supplier

    Hunan

    Wholesale CAS158861-67-7  5mg / Vial Peptide Ghrp 6 , 99% Purity Research Chemicals Peptides from china suppliers

    Brand Name:bodybiological

    Model Number:158861-67-7

    Place of Origin:Hubei, China

    Research Chemical 99% Purity CAS158861-67-7 Peptides Ghrp 6 10mg/vial Basic Information for GHRP-6: Synonyms: GHRP-6 CAS NO.: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular ...

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale White Powder Sermorelin Acetate GRF 1-29 Peptide Hormones Bodybuilding from china suppliers

    Brand Name:LSW

    Model Number:CAS:86168-78-7

    Place of Origin:China

    Rleasing Hormone Polypeptide Lyophilized Powder Sermorelin 2mg with safe delivery and good quality Detail: Product Name: Sermorelin Synonyms: Sermorelin acetate, GRF 1-29 CAS: ...

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier

    Hong Kong

    Wholesale Healthy Growth Hormone Peptides Injectable Polypeptide Hormones GHRP-6 from china suppliers

    Brand Name:NJBN STERIOD

    Model Number:87616-84-0

    Place of Origin:Made-in-China

    Healthy Growth Hormone Peptides Injectable Polypeptide Hormones GHRP-6 Product Details Product name GHRP-6 Cas No. 87616-84-0 Molecular Formula C46H56N12O6 Molecular Weight 873.01 ...

    Nanjing Bangnuo Biotechnology Co., Ltd
    Verified Supplier

    Jiangsu

    Wholesale Sermorelin 2mg/vial Growth Hormone Peptides Lyophilized Powder With Delivery Guarantee from china suppliers

    Brand Name:Shuangbojie

    Model Number:86168-78-7

    Place of Origin:China

    Sermorelin 2mg/vial Growth Hormone Peptides Lyophilized Powder With Delivery Guarantee 1) Sermorelin Details: Name: Sermorelin Synonyms: Sermorelin;Sermorelin acetate;Yadaiftnsyrkv...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Wholesale Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical from china suppliers

    Brand Name:Fulu

    Model Number:86168-78-7

    Place of Origin:China

    Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate, GRF 1-29, CAS Number 86168-78-7 ...

    SuZhou FuLu Biotech Co.,Ltd
    Verified Supplier

    Jiangsu

    Wholesale Sermorelin CAS 86168-78-7 Muscle Building Steroids Growth Hormone Releasing Hormones from china suppliers

    Brand Name:HKGC

    Model Number:86168-78-7

    Place of Origin:China

    Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Molecular formula: C149H246N44O42S Molar Mass: ...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    Wholesale Sermorelin Ipamorelin Ghrp-6 CJC-1295 With DAC EU USA Canada Peptides CAS 86168-78-7 from china suppliers

    Place of Origin:China, TaiZhou

    Brand Name:hugerawyuki@hotmail.com

    Model Number:live:hugerawyuki

    Detailed Product Description Sermorelin Ipamorelin Ghrp-6 CJC-1295 With DAC EU USA Canada Peptides CAS 86168-78-7 USP Sermorelin, TB500, Cjc-1295, Ghrp-6, Ghrp-2, Mgf, Melanotan ...

    Hugeraw Health Technology Co.,Ltd
    Active Member

    Jiangsu

    Wholesale Real Sermorelin growth hormone 2 mg White Power For Injection , Purity 99 % Safe Shipping from china suppliers

    Brand Name:N/A

    Place of Origin:China

    Real Sermorelin 2 mg White Power For Injection From China Purity 99 % Safe Shipping Protuct Name Sermorelin Appearance white power Molecular Formula C149H246N44O42S Place of Origin ...

    Shenzhen Ghormone Biotech Co.,Ltd
    Active Member

    Guangdong

    Go to Page
    Inquiry Cart 0